SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_097620 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_097620
Domain Number 1 Region: 119-415
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-93
Family Protein kinases, catalytic subunit 0.000000155
Further Details:      
 
Domain Number 2 Region: 7-134
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-32
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_097620
Sequence length 439
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=PH domain containing protein kinase, putative | location=DS571386:10921-12360(+) | length=439
Sequence
MSTNHVVKKTGWLVKEGGKWKSWKRRFFVFEQTTLSYYKDQLLFSKMGEIPLELATCIEP
VRRYKKHDYVFKIVTPSRTYYINCADEKDMNDWISCLKEISDRINVSLDKSEDKYVSSED
FDIISLIGKGAFGKVYLVKNKETQTLFAMKVIQKKQVIERDEVQHSLEEKNILAKIKHPF
LVNLYCSFQTSVNLHYVIDYCPGGELYSLMKKEQTMNEKRTKFYAAQLVLALEHLHNQGI
IYRDVKPENILICADGYIRLTDFGLSKMGISDNSKTATFCGTPEYLAPEVIQNVAYTNAI
DWWGLGVLIYEMLYGTVPFYDENIQRLYHNILYNQVTFLEHTEISLECRDIISQLLKKNP
IERLHETDAIKSHPWFHDLHWDNLFAKKVLPDYLPQLSSPTDLRYFYKEITEQSLSLGGE
VVSNELFTDFTYSTTQNQL
Download sequence
Identical sequences A0A175JXG0 C4M933 M2Q1N3 M3TX40 M7VW78 N9V5L1
gi|56465863|gb|EAL44036.1| gi|67466551|ref|XP_649423.1| jCVI|EHI_097620 294381.C4M933 XP_649423.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]