SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_125820 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_125820
Domain Number 1 Region: 115-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-86
Family Protein kinases, catalytic subunit 0.000000342
Further Details:      
 
Domain Number 2 Region: 3-93
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-27
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_125820
Sequence length 441
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=PH domain containing protein kinase, putative | location=DS571160:46407-47833(+) | length=441
Sequence
MPKEGWLAKQGGGWKNWKHRWFVLDGTTLTYYKDQLRMKKMGEIDLMLAFAIVPNEELKL
KNFPYIFSISTPSRVYNISASSSKERDEWIESLLNSKNKKETLIEKEEEEKPISIEDFDI
ITLLGKGAFGKVLLVRYKRTGEKFALKMVEKKKVIEMEELEHTMTEKNILQKVKHPFLVN
LYYSFQSATHLHYVIDYCPGGELYYRLIQEKSFCESRTQFYISQVILALECLHQMNIIYR
DVKLENVLICEDGYLRLTDFGLSKENVSGNETTATFCGTPEYLSPEVVLAEPYTNVIDWW
GVGIMTYEMMHGQAPFISDNIQQLYQKILYSPVIFPTTSPVSAVCKDFITKMLEKKICDR
LSTPEKIKTHPWWNSFDWDALYQKKIPAPFKPDMSQDGKTNFGEEFINEKFDLNEEINNS
TSNGIRQDIFGEFTFTRDEPK
Download sequence
Identical sequences A0A175JH74 C4LVW8 M2R608 M3U3G8 M7X2U3 N9UKV1
gi|56473687|gb|EAL51099.1| gi|67482293|ref|XP_656496.1| XP_656496.1.49425 294381.C4LVW8 jCVI|EHI_125820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]