SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000078 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000078
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-24
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000336
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000308
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000078   Gene: ENSECAG00000000087   Transcript: ENSECAT00000000106
Sequence length 517
Comment pep:known_by_projection chromosome:EquCab2:9:32460451:32786788:-1 gene:ENSECAG00000000087 transcript:ENSECAT00000000106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLARDILMIQEQDVICVSGEPFYSGERTVTI
RRQTIGGFGLSIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCTCAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
SGIIQCLSAEDCIDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKHCFIV
QSESGEDLYFSVELDCDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGSQATASATASSTTTSKAKYMT
Download sequence
Identical sequences F7CP10
9796.ENSECAP00000000078 ENSECAP00000000078 ENSECAP00000000078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]