SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000180 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000180
Domain Number 1 Region: 582-652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.67e-20
Family Complement control module/SCR domain 0.0059
Further Details:      
 
Domain Number 2 Region: 454-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.7e-18
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000021
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 395-454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000786
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 333-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000603
Family Complement control module/SCR domain 0.00062
Further Details:      
 
Domain Number 6 Region: 523-579
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000157
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 7 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000288
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000485
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 9 Region: 91-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000315
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 37-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000655
Family Complement control module/SCR domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000180   Gene: ENSECAG00000000283   Transcript: ENSECAT00000000240
Sequence length 659
Comment pep:known_by_projection chromosome:EquCab2:30:24558059:24586053:1 gene:ENSECAG00000000283 transcript:ENSECAT00000000240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSKDLVFIILLIISGELYAEEKSCGLPNVENGRIAQYYYTFKNFYFPMSIDKKLPFYCL
AGYTTESGKQEGKSTCTSEGWSPAPRCFKKCTKPDLRNGYVSEGKLLYKIQESMRYGCTS
GYKTTGGKDEEVVQCLADGWSSQPTCRQEQETCLAPELHHGNYSTTQKTFKVEDKVQYEC
APGYYTAGGQKTEEVECHTHGWSLTPKCTKLKCSSLRLIENGYFHPIKQTYEEGDVVQFF
CHENYHLSGSDLIQCYNFGWYPESPVCEGRRNRCAPLPLPLNSKIQTHSATYRHGDTVRV
ECKLNFEIQGSEEIHCENGKWTEPPKCIEEKEKIACEEPPIIENGAANITSEIYYNGDKV
TYGCARGYHLRGSKEITCKRGKWTLPPECVENNENCKPPPDVINGAVVDGLSANYTTGSS
VEYKCNEYYLLRGEKTSHCEQGKWSSPPPVCLEPCTLSVDSMNRNNIQIKWKYEGKVLHG
DLIDFVCKQGYGLSPSTPVSELSVPCNRGEMKYPLCIKKEPKRICASPPLIKNGVIINST
GDTYENGSSVEYKCFDHHFLQGSRESYCLEGVWTTPPSCLEPCTLSFAEMEENNLLLKWD
FDNRPYILHGEYIEFLCKRDTYIVQVSVIRSELRVLCDRGQLTYPRCVQIESILFVQEL
Download sequence
Identical sequences F7C7J6
ENSECAP00000000180 9796.ENSECAP00000000180 XP_014593566.1.31192 ENSECAP00000000180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]