SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000210 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000000210
Domain Number - Region: 39-114
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00418
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000210   Gene: ENSECAG00000000355   Transcript: ENSECAT00000000276
Sequence length 166
Comment pep:novel chromosome:EquCab2:21:4110402:4117079:-1 gene:ENSECAG00000000355 transcript:ENSECAT00000000276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTFQVREQNKTQEKELNETEINNLTDKEFKQKVIRMLTDLGRRMDELSENINKGL
ENIKRHSEMKNTILEMKNSLEGLNSRVDDTEEQISELDERLQEITQAEEIKEKIKKNEES
LRDLWDNIKHTNICIIGVPEGEERDKGAQSLCKEIIAENFPNLGKE
Download sequence
Identical sequences F7DUC7
ENSECAP00000000210 9796.ENSECAP00000000210 ENSECAP00000000210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]