SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000227 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000227
Domain Number 1 Region: 534-664
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-38
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-19
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 
Domain Number 3 Region: 197-296
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-17
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000227   Gene: ENSECAG00000000149   Transcript: ENSECAT00000000293
Sequence length 1032
Comment pep:known_by_projection chromosome:EquCab2:X:15923596:16177729:1 gene:ENSECAG00000000149 transcript:ENSECAT00000000293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQE
LILEAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDF
LTSVVDLIGAAKSLLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKI
LHVCKTLSGVCDHIISLSSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGT
TENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLTSA
PALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEPYIPR
DEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKGRSSS
QGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMF
QRNSKKDTGKKSKKKGDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQSSLQ
HKSKKKNKGPIAGKSKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLY
WYINEEDEKAEGFISLPEFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRI
NMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVE
AKHSRLSSTETSQSQSSHEEFRQEVTGSSVVSPIRKTASQRRSWQDLIETPLTSSGLHYL
QTLPLEDSVFSDSVAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGGKPRS
FTLPRDSGFNHCCLNAPVSACDPQDDVQPTEVEEEEEEEEEEEEGEATGENIGDKSESRE
EKLGDSLQDLYRALEQASLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTL
KAREGEVAIIDKVLDNPDLTSKEFQQWKQMYLDLFLDICQNTTPNDPLSISSEVDVITSS
LTHTHSYIETHV
Download sequence
Identical sequences F7DU39
9796.ENSECAP00000000227 XP_005614092.1.31192 ENSECAP00000000227 ENSECAP00000000227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]