SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000247 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000247
Domain Number 1 Region: 283-447
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 461-584
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-22
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 576-660
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-16
Family PDZ domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000247   Gene: ENSECAG00000000271   Transcript: ENSECAT00000000320
Sequence length 667
Comment pep:known_by_projection chromosome:EquCab2:23:21206382:21267908:1 gene:ENSECAG00000000271 transcript:ENSECAT00000000320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYTHRLFHAARTSPTPSLRRLRGLQEHVYEEIGDAPELDARDGLRLYEQERDEAAAYRQE
ALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKA
AEDMPEAEQDLERAPTPGRGRPDSPGLQALAGQQRAAGTVGGEAVQRYSKEKRDAISLAI
KDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPL
GAESSSTPLHPSDPAEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQ
LLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLN
ADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICH
VFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSK
SENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSIN
GTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICS
LMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTA
QEQPVYI
Download sequence
Identical sequences F7DTH7
ENSECAP00000000247 ENSECAP00000000247 9796.ENSECAP00000000247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]