SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000319 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000319
Domain Number 1 Region: 955-1085
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.55e-46
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 49-178
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-21
Family Synaptotagmin-like (S variant) 0.0046
Further Details:      
 
Domain Number 3 Region: 211-290
Classification Level Classification E-value
Superfamily PDZ domain-like 3.86e-17
Family PDZ domain 0.0000156
Further Details:      
 
Domain Number 4 Region: 468-571
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000393
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000319   Gene: ENSECAG00000000199   Transcript: ENSECAT00000000411
Sequence length 1091
Comment pep:known_by_projection chromosome:EquCab2:25:18345282:18464883:1 gene:ENSECAG00000000199 transcript:ENSECAT00000000411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVLSASCGLSLRLPIFLGRMEWQSQDISMPRKDACTQTSPARRKIGHAQVQGAGQLKLA
IDAQDRVLLLHIIEGKGLVSREPGICDPYVKISLIPEDNRIRRQKTQTIPGCRDPVFQEH
FFFPVQEEDEQKRLLVTVCNGAGDSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEDLG
RTKHLKVARRRLRPLRDPLLRMPGGGHAENGEKLKITIPRGKDGFGFTICCDSPVRVQAV
DSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPD
GGVLRRASCKSTHDLQSPPNKREKNCTHGAQARPEQRRSCHLVCDSSDGLLLGGWERYTE
VAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDAIPEESGSPSQGKPYT
GLGKKSRLMKTVQTMKGHGNYQNCPVMRPHTPHSSYGTYVTLAPKVLVFPVFVQPLDLCN
PARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEG
SSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLSASPPENKMFESE
ADEKREMPSEEGKGPGAEDAPPSKDPSPGPEPRPGQGLPTSKDSSSDQEPSLGQESLPNK
DSPSCKEAPPGREPSPSKDSPPVPAPTPGQDLPARQEAPPSQAALLSKDPPAQDLPPRQD
PAKVLAEETTCSEDAPAATRDPPVASRPTFVIPEVRLDSTYSQKAGAEGGSSGEEEDAEE
AEEGEEGEEEEEEDTSDDNYGGRSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSL
LQEARGACFASDTTLHCSDGEGAASSWAMPSPRTLKKELGRNGGSMHHLSLFFTGHRKMS
GPDTAGDDDEAARKRKGKNLAKDMKNKLGIFRRRNESPGAQPAGKADKVMKSFKPTSEEA
LKWGESLEKLLLHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFA
EYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLD
LINQKKMSPPL
Download sequence
Identical sequences F7D462
9796.ENSECAP00000000319 ENSECAP00000000319 ENSECAP00000000319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]