SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000458 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000458
Domain Number 1 Region: 476-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-61
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 322-462
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 119-177
Classification Level Classification E-value
Superfamily L27 domain 8.83e-23
Family L27 domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 253-337
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-19
Family PDZ domain 0.000032
Further Details:      
 
Domain Number 5 Region: 184-235
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000447
Family L27 domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000458   Gene: ENSECAG00000000356   Transcript: ENSECAT00000000586
Sequence length 675
Comment pep:known_by_projection chromosome:EquCab2:24:13594286:13653235:1 gene:ENSECAG00000000356 transcript:ENSECAT00000000586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSHMNGHVTEESDFEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPVRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVK
ILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIYNAVTVHMNKASPPF
PLISNAQDLAQEVQTVLKPVHQKEGQELTTLLNAPHIQALLLAHDKVAEQEMQLEPIADE
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSVRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
Download sequence
Identical sequences F7C695
ENSECAP00000000458 9796.ENSECAP00000000458 ENSECAP00000000458 XP_001499734.1.31192 XP_008535569.1.77740 XP_014691346.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]