SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000622 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000622
Domain Number 1 Region: 230-450
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.08e-51
Family Reprolysin-like 0.0038
Further Details:      
 
Domain Number 2 Region: 543-593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 973-1029
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000654
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 857-922
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 925-968
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 803-862
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000622   Gene: ENSECAG00000000579   Transcript: ENSECAT00000000777
Sequence length 1093
Comment pep:known_by_projection chromosome:EquCab2:1:105238094:105572574:-1 gene:ENSECAG00000000579 transcript:ENSECAT00000000777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGALLPPLVLPLLLLLFWGLDPGTGSAPSPTAPFFASASRRHLPSALHGCGTPPVGAT
RELARRPTNRPGAARPRRAQRLLLQPAGPFGADLYLQLRRDLRFLSRGFEVEEPDVAERR
GTPRPSCAFYSGRVLGHPGSLVSLSACGAGGLVGLIQLGQEQVLIQPVNNSQSSLSGQEH
LIRRKWSLTPSPSTDTQVPGRLCKVLTEKKPRRGRPSRDWRERRNAIQLTNEHTVETLVV
ADADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKVNIQVTKLVLLRQRPAKLSIGHH
GERSLESFCHWQNEEYGGARYLGNNQVPGGKDDTPPVDAAVFVTRTDFCVHKDEPCDTVG
IAYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVK
GRNPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSQHAVRLPHKLPGMHYSANEQCQIL
FGTNATFCRNMEHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIP
EHVDGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCLGASVEHAVCENLPCPK
GLPSFRDQQCQTHDRLSSKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCG
PYETDLCVHGRCQKIGCDGIIGSAAKEDRCGVCSGDGKTCRVVKGDFSHSRGTALKDSNK
RSINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKTPLYLMVLLFHDQNYGIHYE
YTVPVNYTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTQIVNKTTTLVN
DSDCPQASRPEPQVRRCNSHPCQSRWVAGPWSPCSATCEKGIQHREVTCVYQLQNGTHVA
TRPLYCPGPRPAPVQSCEGQDCLSIWEASEWSQCSANCGKGTQKRTVTCTNSQGKCDAST
RPKAEEVCEDYSGCYEWKTGDWSKCSSTCGKGLQSRVVQCMHKVTGRHGNECPALSKPAA
YRQCHQEVCNDKINVNTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQT
CRDFYANKMRQPL
Download sequence
Identical sequences F7D7K7
ENSECAP00000000622 ENSECAP00000000622 9796.ENSECAP00000000622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]