SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001015 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000001015
Domain Number - Region: 25-106
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000915
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001015   Gene: ENSECAG00000001474   Transcript: ENSECAT00000001308
Sequence length 275
Comment pep:novel chromosome:EquCab2:3:46785062:46785889:-1 gene:ENSECAG00000001474 transcript:ENSECAT00000001308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETETSDLLDKEFKQNTMRMLTDMQRRMDEHSEHISKELEDIEKNQSEMKNTILEMRNSLE
GLNSRVEEAEERISELDKRLEEITQAEQKTEKRIRQNENSVRELWDNIKRSNIQIVGVPE
GEERDKGAKNLFVKIIEENCPHLRKEIDIQVQEAQRAPNKRSPKRPTPRHIIIKMSKIKD
KERILKAARERPQVTYTGKPIRLSADFSAETQQVRREWHDIFEVLKGKNLQPRILYPSRL
SFRMEGEIKSFPDKQKLKEFITKKPVLQEMLQALI
Download sequence
Identical sequences F6VN21
9796.ENSECAP00000001015 ENSECAP00000001015 ENSECAP00000001015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]