SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001021 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001021
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001021   Gene: ENSECAG00000001476   Transcript: ENSECAT00000001317
Sequence length 59
Comment pep:novel chromosome:EquCab2:22:34495742:34495918:1 gene:ENSECAG00000001476 transcript:ENSECAT00000001317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPAFCLEPPYVGRCRAMIRRYFYNATSAQCETFTYGGCRQKKNNFISKEECLKTCRGE
Download sequence
Identical sequences F6VMN7
ENSECAP00000001021 ENSECAP00000001021 9796.ENSECAP00000001021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]