SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001036 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000001036
Domain Number - Region: 34-130
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000798
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001036   Gene: ENSECAG00000001522   Transcript: ENSECAT00000001340
Sequence length 174
Comment pep:novel chromosome:EquCab2:3:47431491:47432012:1 gene:ENSECAG00000001522 transcript:ENSECAT00000001340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNAFQARELDKTPEKGLNEIETSDLLDKEIKQCIMRMLTDMGRRLDKHSEHISKKL
ENIKRNQSEMKNTILEMKNSLKGLNSIVEDAEEGISELDERVEEITQAEQKKEKRSRQNE
NSLRELWDNIKHADIWITGVPEGEERDKGAENLFEEIIDENFPNLRKETNIQFQ
Download sequence
Identical sequences F6VLU2
ENSECAP00000001036 9796.ENSECAP00000001036 ENSECAP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]