SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001077 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001077
Domain Number 1 Region: 136-337
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.18e-54
Family Prokaryotic proteases 0.00000051
Further Details:      
 
Domain Number 2 Region: 348-443
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family HtrA-like serine proteases 0.0022
Further Details:      
 
Domain Number 3 Region: 16-87
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.0025
Further Details:      
 
Domain Number 4 Region: 73-121
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000471
Family Ovomucoid domain III-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001077   Gene: ENSECAG00000000727   Transcript: ENSECAT00000001403
Sequence length 446
Comment pep:known_by_projection chromosome:EquCab2:3:115939901:115975692:1 gene:ENSECAG00000000727 transcript:ENSECAT00000001403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGLAALALATELPAAPCPASCDVSRCPSSRCPGGYVPDLCNCCLVCAAGEGEPCGRPLD
SPCGESLECARGVCRCRWAHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACP
SGLHHLTSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIV
TNAHVVSSTNSVSGRQQLKVQLQNGDTYEATIQDIDKKSDIATIKIHPKKKLPALLLGHS
GDLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMDYIQTDAIINYGNSGG
PLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLTEFQDKHIKDWKKRFIGIRMRTITPS
LLEELKASNPDLPTVSSGIYVQEVVPNSPSQRGGIQDGDIIVKVNGRPLADSSELQEAVL
NESPLLLEVRRGNDDLLFSIAPEVVV
Download sequence
Identical sequences F6UXP1
9796.ENSECAP00000001077 ENSECAP00000001077 ENSECAP00000001077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]