SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001119 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000001119
Domain Number - Region: 42-129
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00259
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001119   Gene: ENSECAG00000001614   Transcript: ENSECAT00000001473
Sequence length 297
Comment pep:novel chromosome:EquCab2:19:16417870:16418763:1 gene:ENSECAG00000001614 transcript:ENSECAT00000001473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRHRNSFQAREHYKTPEKEPSETETSNLLDKEFKQNIMRMLTDMQRRMDEHSAHISKEL
EDIKKNQSEMKNTILEMRNSLEGLNSRVEEAEKLISELDERLEEITQAEQKREKRIRQNE
NSVRELWDNIKHANIRIIGAQEGEERDKGAENLFVKIIEENFPHLRKETDIQVQEAQRAP
NKRSPKRPTPRHIIIKMSKIKDKERILKAARERPQVTYKGKPIRLSADFSAETLQARREW
HDIFEVLKGKNLEPRILYPSRLSFRMEGEIESFPDKQKLKELITKKPVLQEMLKGLI
Download sequence
Identical sequences F6TUT1
ENSECAP00000001119 ENSECAP00000001119 9796.ENSECAP00000001119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]