SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001157 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000001157
Domain Number - Region: 40-101
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00445
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001157   Gene: ENSECAG00000001720   Transcript: ENSECAT00000001531
Sequence length 167
Comment pep:novel chromosome:EquCab2:19:17457962:17458462:1 gene:ENSECAG00000001720 transcript:ENSECAT00000001531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQAREQDKTPEKELNETEISNLPDKEFKQKLIRMLTDIGRSLDEHSEIVNKELENIKKKQ
SEMKHTMLEMKNSLDELNSRIDDTEEWMSELDERLQEITQAKQIKGKRIKKNENSLRELW
DNIKCANILIIGVPEGEEREKSAENLFEEIVAENFPNLRREIDFQVQ
Download sequence
Identical sequences F6TMJ8
ENSECAP00000001157 9796.ENSECAP00000001157 ENSECAP00000001157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]