SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001313 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001313
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.64e-71
Family p53 DNA-binding domain-like 0.0000012
Further Details:      
 
Domain Number 2 Region: 347-413
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.17e-23
Family SAM (sterile alpha motif) domain 0.000018
Further Details:      
 
Domain Number 3 Region: 203-243
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000262
Family p53 tetramerization domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001313   Gene: ENSECAG00000000771   Transcript: ENSECAT00000001767
Sequence length 495
Comment pep:known_by_projection chromosome:EquCab2:2:46386866:46393944:-1 gene:ENSECAG00000000771 transcript:ENSECAT00000001767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTEVVKRCPNHELGRDL
NEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCV
GGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESAAKNA
AAGKRAFKQSPPAIPALGTNVKKRRHGDEDTYYMHVRGRENFEILMKVKESLELMELVPQ
QLVDSYRQQQQQQQLLQRPSPLQSPSYGPVLSPMNKAHGGISKLPSVNQLVGQPPPHSSA
AGPNLGPMGPGILNNHGHALPANGEMNGSHSSQSMVSGSHCTPPPPYHADPSLVSFLTGL
GCPNCIEYFTSQGLQNIYHLQNLTIEDLGALKIPDQYRMTIWRGLQDLKQGHDYGAQQLI
RSSSNASTISIGSSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGSGPDEWADFGFDLPD
CKSRKQSIKEEFTES
Download sequence
Identical sequences F6U7N6
9796.ENSECAP00000001313 ENSECAP00000001313 ENSECAP00000001313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]