SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001558 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000001558
Domain Number - Region: 47-128
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000732
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001558   Gene: ENSECAG00000002360   Transcript: ENSECAT00000002195
Sequence length 174
Comment pep:novel chromosome:EquCab2:15:64897986:64898507:-1 gene:ENSECAG00000002360 transcript:ENSECAT00000002195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTFQAREHYKTPEKELSETETSDLLDKEFKQNTMRMLTGMQRRMDEHSEHISKEL
EDIKKNQSEMKNTILEMRNSLEGLNSRVEEAEELISELDERLEKITQAEQKREKRIRQNE
NSVRELWDNIKCANIQIIGILEGEERDKGAENLFVEIIEENFPHLRKETNIQVQ
Download sequence
Identical sequences F6ULA3
ENSECAP00000001558 9796.ENSECAP00000001558 ENSECAP00000001558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]