SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001668 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001668
Domain Number 1 Region: 204-231
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00000082
Family T-box 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001668   Gene: ENSECAG00000002502   Transcript: ENSECAT00000002345
Sequence length 231
Comment pep:novel chromosome:EquCab2:18:41928878:41929573:1 gene:ENSECAG00000002502 transcript:ENSECAT00000002345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMT
NQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAP
SAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPAAGYPYPQQY
GHSYQGAPFYQFSSTQPGLVPGKAQVYLCNRPLWLKFHRHQTEMIITKQGR
Download sequence
Identical sequences F6T3P8
ENSECAP00000001668 ENSECAP00000001668 9796.ENSECAP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]