SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001772 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001772
Domain Number 1 Region: 5-169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-28
Family MAM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 222-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 177-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 264-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001772   Gene: ENSECAG00000002568   Transcript: ENSECAT00000002489
Sequence length 321
Comment pep:known_by_projection chromosome:EquCab2:29:16119046:16220988:-1 gene:ENSECAG00000002568 transcript:ENSECAT00000002489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTSTTGSCNFETTTGNWTTACNLTQDSQDDLDWAIGSRIPTEALSADSDHTPGSGRHFLY
VNSSGPKEGFTARVTTSQSFPASLGMCTVRFWFYMVDPRSLGILKVYIIEESGLNILEWS
VIGNKRTGWMYGYAPLSSNSPFKVAFEADLSGNEDIFIALDDISFTPGCVFGGPVTTQPS
PCEADQFSCVYTLQCVPLSRKCNGQEDCIDGSDEMDCSLSPPSQLCGKMEFQCSTNECIP
SLLLCDGVPDCHFNEDESSCSNESCSNGALMCPSSNSCIPAHWRCDGFADCMDFQLDESS
CSECPINYCRNGGACVVKKNG
Download sequence
Identical sequences F6V8H0
9796.ENSECAP00000001772 ENSECAP00000001772 ENSECAP00000001772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]