SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002006 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002006
Domain Number - Region: 43-130
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00157
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002006   Gene: ENSECAG00000002970   Transcript: ENSECAT00000002801
Sequence length 174
Comment pep:novel chromosome:EquCab2:10:34733572:34734093:-1 gene:ENSECAG00000002970 transcript:ENSECAT00000002801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRQWNILQAREQDKTPEKGLNETEIIDLLKKEFKQNIMRMLTDMGRRMDEHREHISKEL
EDIKRNQSEMKNTILEMRNSLEGLNSRVEEGEERISELDERLEEITQAEQKKGKRVRQNE
NSVREYWDNIKCANIRITGVPEGEERDKGAENLFEEIIDENFPNLRKETDIQVQ
Download sequence
Identical sequences F7E006
9796.ENSECAP00000002006 ENSECAP00000002006 ENSECAP00000002006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]