SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002073 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002073
Domain Number - Region: 34-134
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000157
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002073   Gene: ENSECAG00000003060   Transcript: ENSECAT00000002895
Sequence length 174
Comment pep:novel chromosome:EquCab2:6:33290503:33291024:1 gene:ENSECAG00000003060 transcript:ENSECAT00000002895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQRNTFQPREQDKTSEKGLNETEISNLSNKEFKQKLIRMLTDIGRRLDEHRELINKEL
ENIKKNQSEMKNTILEMKNSLEELNSRVEDTEEWISELDERLEEITQAEQKKEKRIRQNE
NSLRELWDNIKRTNIRIIGIPEGEERDKGAENLFEEIIDENFPNLRKETNIQVQ
Download sequence
Identical sequences F6XE09
ENSECAP00000002073 9796.ENSECAP00000002073 ENSECAP00000002073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]