SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002230 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002230
Domain Number - Region: 48-131
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00262
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002230   Gene: ENSECAG00000003243   Transcript: ENSECAT00000003121
Sequence length 296
Comment pep:novel chromosome:EquCab2:27:6802679:6803569:1 gene:ENSECAG00000003243 transcript:ENSECAT00000003121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQRNTFQAREQNKTPEKGLNETETRDLLNKEFNQNIMRMLTDMGRRMDEHSEHIGKELE
NIQENQSEMKNTILEMSNSLEGLNSRVEDTEEWISEPDERLEEITQAEEKREKRIRQNEN
SLRELWDNIKHANIRIIGVQEGEERDKGEENLFVEIIDENFPNLRKETDIQGQEAQRAPN
KISPKRLTPRHIIIKTSKIKDKERILKAARERPQVTYKGKPIRLSVDFSAETLQARREWH
DVFKVLKGNNLQPRIFYPSSLSFRMEGEIKSFPDKQKLKEFITKKPVLQEMLKGLI
Download sequence
Identical sequences F6X746
ENSECAP00000002230 ENSECAP00000002230 9796.ENSECAP00000002230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]