SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002830 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002830
Domain Number 1 Region: 157-288
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-41
Family C-type lectin domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000002830
Domain Number - Region: 78-151
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002830   Gene: ENSECAG00000003702   Transcript: ENSECAT00000004100
Sequence length 290
Comment pep:known chromosome:EquCab2:7:4554655:4557523:1 gene:ENSECAG00000003702 transcript:ENSECAT00000004100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAPYCRWGGGLEEALGGSWGRWGRRLLFLVLSLMVATVLWALILTVLFSKASTERGVL
LGHQDLLRTNASRQTAVLAALKEKVSVCNSCCQETQAQLQTARTELGEAREKLFQQESDL
KELSERVTQGLAEAGRDREDIRTELLRALEAARLRNSSCEQCPASWLPFQGSCYFFSEIT
ATWDEAQRRCVGASAHLVIVRGLEEQGFLSRNTRGRGYWLGLRAVRRARKIQSYQWVDGV
SLSFSYWNQGEPNDAQGREDCVMMLRTGMWNDAPCNSERDSWICEKRQSC
Download sequence
Identical sequences F6WVS1
ENSECAP00000002830 9796.ENSECAP00000002830 ENSECAP00000002830 XP_001496885.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]