SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002942 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002942
Domain Number - Region: 41-129
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002942   Gene: ENSECAG00000004413   Transcript: ENSECAT00000004260
Sequence length 173
Comment pep:novel chromosome:EquCab2:1:83379544:83380062:1 gene:ENSECAG00000004413 transcript:ENSECAT00000004260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEAKNTFQAREQYKTPEKELSETETSDLLEKEFKQNIMRMLTDMRRRMDEHSEHISKELE
DIKQNQSEMKNTILEMRNSLEGLNSRVEDAEERISKLDESLEEITQAEQKREKRIRQNEN
SVRELWDNIKHANIQIIGVPEGEERDKGAENLFVEIIEENFPHPRKETDIQVQ
Download sequence
Identical sequences F7AZ13
ENSECAP00000002942 ENSECAP00000002942 9796.ENSECAP00000002942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]