SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003000 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003000
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.37e-62
Family T-box 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003000   Gene: ENSECAG00000004398   Transcript: ENSECAT00000004348
Sequence length 213
Comment pep:known_by_projection chromosome:EquCab2:Un0002:784200:787309:1 gene:ENSECAG00000004398 transcript:ENSECAT00000004348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKADPATPGRVH
YHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRKDSEK
YAEENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPGALPL
MSAFARSRNPVASPTPPNGAEKEAAEARRRIRA
Download sequence
Identical sequences H9GZR8
ENSECAP00000003000 9796.ENSECAP00000003000 ENSECAP00000003000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]