SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003069 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003069
Domain Number 1 Region: 62-173
Classification Level Classification E-value
Superfamily PH domain-like 7.25e-38
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-17
Family PDZ domain 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000003069
Domain Number - Region: 210-309
Classification Level Classification E-value
Superfamily PH domain-like 0.00599
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003069   Gene: ENSECAG00000003760   Transcript: ENSECAT00000004438
Sequence length 413
Comment pep:known_by_projection chromosome:EquCab2:3:19285293:19374193:1 gene:ENSECAG00000003760 transcript:ENSECAT00000004438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSIKGGRENRMLILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATYDQAVPALKRMG
KEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKVIP
LKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALLPQVL
AELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTR
DAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLST
WTRILVQGCHAAAELIKEVSLGCTLNGQEVRLNVHYENGFTISRENGGSSSILYRYPFER
LKMSADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences F6PKW7
ENSECAP00000003069 ENSECAP00000003069 9796.ENSECAP00000003069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]