SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003113 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003113
Domain Number - Region: 48-86
Classification Level Classification E-value
Superfamily Elafin-like 0.000144
Family Elafin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003113   Gene: ENSECAG00000004502   Transcript: ENSECAT00000004495
Sequence length 201
Comment pep:known_by_projection chromosome:EquCab2:3:31556302:31580181:1 gene:ENSECAG00000004502 transcript:ENSECAT00000004495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLLLLLLRAASAKNIWKRALHARLAEKSRVSPGGRPGGDAPGPAGAPPLPTTLGPSIID
GVSCQRDQPCPRRRCCYNGCAYACLEASLPPPPFLDWLVQPKPRWLGGNGWLLDGPEETL
QAEACSTTEDGAEPLLCPSGYECHILSPGDMAEGIPNRGQCVKQRRQADGRFLRHKFHRE
YPEGDSKNVAEHGKGQQRHFQ
Download sequence
Identical sequences F6SC02
ENSECAP00000003113 ENSECAP00000003113 9796.ENSECAP00000003113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]