SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003315 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003315
Domain Number - Region: 35-134
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00102
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003315   Gene: ENSECAG00000004901   Transcript: ENSECAT00000004770
Sequence length 181
Comment pep:novel chromosome:EquCab2:26:19462365:19462907:-1 gene:ENSECAG00000004901 transcript:ENSECAT00000004770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIMKNTLQAREQDKTPEKGLKETEASDLLDKEFKQNIMRMLRDIGRRLDEHSELMSKELE
DIKRKQSERKNTILEMKDSLERLNSRVEDAEERIRELDERLEETTQAAQKKEKRIRQNER
SLRELWDNIKHANIQIIGVPEGEERHKGAENLFEEIINENFPILRKETHIQVQEAQSSKQ
D
Download sequence
Identical sequences F6SXY2
9796.ENSECAP00000003315 ENSECAP00000003315 ENSECAP00000003315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]