SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003335 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003335
Domain Number - Region: 50-110
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0068
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003335   Gene: ENSECAG00000004910   Transcript: ENSECAT00000004797
Sequence length 297
Comment pep:novel chromosome:EquCab2:24:25814578:25815471:-1 gene:ENSECAG00000004910 transcript:ENSECAT00000004797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTFQAREEDKTPEKELSETEISNLCDKELRQKLIRLLTDIGRRLDEHSENVNKEL
ENIKKNQSEMKNTILEMTNSLEGLNSIVDDTEEWISELEERLEEITQAEQMKEKRIRQNE
NSLRELWDNIKCTNIWIIGVPEEEERDKGAENLFEKIIAENFPNLRKETDIQIQEAQTAP
NKINPRRPTSRHIIIKMSKIKDKKKILKAARERQQVTYKGKPISLLADFSAETLQARREW
HDIFKVLKGKNLQPRILYPARLSFRMEGEITSFPDKQKLKEFITKKPVLQEMLTGVI
Download sequence
Identical sequences F6SX76
9796.ENSECAP00000003335 ENSECAP00000003335 ENSECAP00000003335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]