SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003349 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003349
Domain Number 1 Region: 598-662,700-798
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-31
Family Pleckstrin-homology domain (PH domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 1216-1349
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Domain Number 3 Region: 804-922
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000003349
Domain Number - Region: 1118-1197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000279
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 27-120,705-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000429
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003349   Gene: ENSECAG00000003331   Transcript: ENSECAT00000004814
Sequence length 1493
Comment pep:known_by_projection chromosome:EquCab2:15:54866936:54959857:-1 gene:ENSECAG00000003331 transcript:ENSECAT00000004814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSETEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEEKLKAANIQTSESETRLYKKCQDLETLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRRIQSKLQEVQGKKSSTVSTP
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDIEEMEIPEQSVDN
HIQENNRGQRTLHQTSCVPEQNRKARTSFVTDGGVSQNSGAPVSDWSSDEEDGSKERSKS
RYTSTLSSHTSEEGVHCSRMGSETYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQW
KAQNCPLGKGSSESSKKEHDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALTPKHP
NSLPGKGTHLVPSSNLPPAKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDGDSTEVLETMDTSCDDGLFSYDSLESPCSDDQETCDSAKKAACSKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMENVNKNSVAVLSYTTSGLYTSLIYKNMTTP
VYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDTRSRSGPGSPRAMKRGVSLS
SVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKTW
KRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTAD
SPNILEEWIKVLQNVLRVQAANPLFLQPEGKPAVKGLLTKVKHGYSKRVWCTLIGKTLYY
FRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLL
IGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIEGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHVSLAQSALQICLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKDQ
QPGKWEGTRTVRLTYKNRLYFSMQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA
ALLAQVEIGDFERPFSTPAGHVTNQCKANQTLKQVIEKFYPKRYRDDSSEEQLRQLCQRL
STRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFLWLAIHEDGLSI
LEYNSMRLIVSYVYKSLMTFGGHQDDFMIVINNTHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKAAFHHLSAPALLSARTQGPQARAMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences F6SWM6
XP_001499637.1.31192 ENSECAP00000003349 ENSECAP00000003349 9796.ENSECAP00000003349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]