SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003472 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003472
Domain Number 1 Region: 141-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-25
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 2 Region: 3-83
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000523
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 80-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000677
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 405-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000794
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000003472
Domain Number - Region: 358-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003472   Gene: ENSECAG00000005001   Transcript: ENSECAT00000004966
Sequence length 437
Comment pep:known_by_projection chromosome:EquCab2:20:56777230:56935956:-1 gene:ENSECAG00000005001 transcript:ENSECAT00000004966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEMTADGKPPIQKKDTETPHASQAYFESMFLGHVPTNVKIHKKAGPIYGFRGCIRELQV
NDKEFFIIDEALRGRNIENCHVPWCAHHLCHNNGTCISDSENWFCECPRLSSGKLCQFAT
CENNPCGNGATCVPKSGTEIVCLCPYGRSGVLCTDAINITQPSFSGTDAFGYTSFLAYSR
VPDIGFDYEFHVTFQLANNHSALQNNLIFFTGQKGHGRNGDDFLAVGLRDGRVVYSYNLG
SGIASVSSDPLDRSLGIHAVRLGRFLQMGWLKVDDHKNKSIVAPGRLVGLNVFSQFYVGG
YSEYTPELLPNGSEFKNGFQGCIFSLRVRTGKNGRFRSLGDPEGRSAAGRSVAQCGASAC
GSGRCGHGGACAESGGAVHCDCPSGWKGAFCTEMVSTCDPEHDPPHNCSKGATCVPLPHG
YTCRCPLGTTGIYCERG
Download sequence
Identical sequences F6RAH7
ENSECAP00000003472 ENSECAP00000003472 9796.ENSECAP00000003472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]