SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003694 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003694
Domain Number - Region: 109-185
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.019
Family Reprolysin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003694   Gene: ENSECAG00000023026   Transcript: ENSECAT00000005263
Sequence length 200
Comment pep:known chromosome:EquCab2:25:20653601:20654200:1 gene:ENSECAG00000023026 transcript:ENSECAT00000005263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWKVARTQREVLLDMETHGLHTPLPQLLLQENWDNVKRAWSPMKDGNSPQVEFTGAHGFL
LDTSLEPPLCGQTLCDNTEVIASYNQLPRFRRPKVVRYRVVNLHDDGHENPTVSRQQIDF
QHRQLAEAFKHYNISWELEVLEVNNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDG
GDCRHLRHPAFVKKQQNGVC
Download sequence
Identical sequences F6RRD9
ENSECAP00000003694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]