SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003827 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003827
Domain Number - Region: 34-135
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003827   Gene: ENSECAG00000005488   Transcript: ENSECAT00000005436
Sequence length 296
Comment pep:novel chromosome:EquCab2:18:12606859:12607749:1 gene:ENSECAG00000005488 transcript:ENSECAT00000005436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGEKNTFQAKEQDKTPEKGLNETETNDLLDKEFKQNIMRMLTDMGRRMDEHSEHISKEL
EDIKKTVRMKNTILEMRNSLEGLSSRVEEAEEWISEVDERLEEITQAEQKREKRIKQNEN
SLRELWDNIKSTNIRIIGVPEGEERDKRAENLFIKIIDENFPNLRKETDIQVQEAQRAPN
KRSPKRPTPRHIIIKISKIKDKERILKAARERPQVTYKGKSIRLSVDRSVETLQVRREWH
DIFKVLKGKNLQLRIFYPSRLSFRMEGEIKCFPDKHKLKEFITKKPVLQDMMKGLI
Download sequence
Identical sequences F6ST25
9796.ENSECAP00000003827 ENSECAP00000003827 ENSECAP00000003827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]