SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003865 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003865
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000149
Family L-arabinose binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003865   Gene: ENSECAG00000005593   Transcript: ENSECAT00000005489
Sequence length 82
Comment pep:novel chromosome:EquCab2:7:15222370:15222615:1 gene:ENSECAG00000005593 transcript:ENSECAT00000005489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGA
LLSLLDHYEWNCFVFLYDTDRG
Download sequence
Identical sequences F6SKH0
9796.ENSECAP00000003865 ENSECAP00000003865 ENSECAP00000003865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]