SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003963 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003963
Domain Number 1 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003963   Gene: ENSECAG00000005716   Transcript: ENSECAT00000005616
Sequence length 40
Comment pep:novel chromosome:EquCab2:18:25016475:25016594:-1 gene:ENSECAG00000005716 transcript:ENSECAT00000005616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLDT
Download sequence
Identical sequences F7CU16 Q4ZG53
ENSECAP00000003963 9796.ENSECAP00000003963 ENSECAP00000003963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]