SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004198 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000004198
Domain Number - Region: 49-107
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0235
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004198   Gene: ENSECAG00000006040   Transcript: ENSECAT00000005969
Sequence length 282
Comment pep:novel chromosome:EquCab2:24:43460205:43461050:1 gene:ENSECAG00000006040 transcript:ENSECAT00000005969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRHTFQAREKDKAPERELNETEINNLPDKEFKRKVIRMLTDLWRRMDELSENFNKEL
ENIKKNQLEMKNIILEMKNSLEGLNSRVDDTEEQISELDESLEEITQAEQIKGKRIKKNK
DSLREIWDNIKHTNIHSTGVPEEEERDKGAENLSEEIIAENFPNLRKETDIQVQETQRAS
NKMNPKRPTPRHIIIKMSKIKDKERILKAARERQQVTYKGNPIRLLANFSAETLQARREW
HDIFKALKGKNLQPRILYSGRLSFRMEGEMKSFPDKQKLKEF
Download sequence
Identical sequences F7A157
ENSECAP00000004198 ENSECAP00000004198 9796.ENSECAP00000004198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]