SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004275 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004275
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000085
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004275   Gene: ENSECAG00000006139   Transcript: ENSECAT00000006071
Sequence length 64
Comment pep:novel chromosome:EquCab2:27:36439152:36439343:1 gene:ENSECAG00000006139 transcript:ENSECAT00000006071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGHAILTCIVSPGNGASWDFPA
PFCR
Download sequence
Identical sequences F6Z9G2
ENSECAP00000004275 9796.ENSECAP00000004275 ENSECAP00000004275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]