SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004307 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000004307
Domain Number - Region: 49-131
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0523
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004307   Gene: ENSECAG00000006157   Transcript: ENSECAT00000006112
Sequence length 296
Comment pep:novel chromosome:EquCab2:6:80538774:80539661:-1 gene:ENSECAG00000006157 transcript:ENSECAT00000006112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTFQAREQYKTPEKELSETETSDLLDKEFKQNIMRMLTDKRRRMDEHSEHISKEL
EDIKKKPEMKNTIFEMRNSLEGLNSRVEEAEERISELDERLEENTQAEQKREKRIRQNEN
SVRELWDNIKSANIRIIGVPEGEERHKGAENLLVEIIEENFPNLRKETDIQVQEAQRAPN
KISPKRPTPRHIIIKMSKIKDKERILKAARERPQVTYKGKPIRLSADFSVETLQARREWH
DIFKVLKGKNLQPRILYPSRLPFRTEGEIKSFPDKQKLKEFITNKPVLQEMLKGLI
Download sequence
Identical sequences F7B6U3
ENSECAP00000004307 ENSECAP00000004307 9796.ENSECAP00000004307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]