SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004368 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004368
Domain Number 1 Region: 83-276
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.08e-75
Family T-box 0.000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004368   Gene: ENSECAG00000005787   Transcript: ENSECAT00000006192
Sequence length 550
Comment pep:known_by_projection chromosome:EquCab2:10:38267482:38293611:-1 gene:ENSECAG00000005787 transcript:ENSECAT00000006192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEAAAAAAARARRAPLRETKALGRRPGPPGAAQTWSGAAGGCEDGFLQGAAPLASPGGS
PKGSPAPTLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKIS
GLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMR
QVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFS
FPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTF
EDIPGIPKQGNTSSSTLLQGSGNGVPATHPHLLSGSPCSSPAFHLGPNTSQLCSLAPADY
SACARSGLALNRYSTSLAETYNRLTNQTSETFAPPRTPSYVGVSSGASVNMSMGGADGDT
FSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTS
PKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTL
SSSQVSAHMV
Download sequence
Identical sequences F7B1K4
9796.ENSECAP00000004368 ENSECAP00000004368 ENSECAP00000004368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]