SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004484 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000004484
Domain Number - Region: 69-158
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0034
Family Coiled-coil dimerization domain from cortexillin I 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004484   Gene: ENSECAG00000006408   Transcript: ENSECAT00000006348
Sequence length 172
Comment pep:novel chromosome:EquCab2:X:107722315:107722830:1 gene:ENSECAG00000006408 transcript:ENSECAT00000006348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTLQAREQYKTPKKGLNETETSDLLDEEFKQNIMRMLTDMGRRMDEHSEHISKEL
EDIKKTSEMKNTILEMRNSLEGLNSRVEESERISELDERLEEITQAEQKREKRIRQNENS
LRELWNNIKHANIWIIDVPEREERDKRAENLFVEIIDENFPNLRKERDIQLQ
Download sequence
Identical sequences F7A411
ENSECAP00000004484 ENSECAP00000004484 9796.ENSECAP00000004484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]