SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004714 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004714
Domain Number 1 Region: 113-223
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-29
Family C-type lectin domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004714   Gene: ENSECAG00000006504   Transcript: ENSECAT00000006618
Sequence length 225
Comment pep:known_by_projection chromosome:EquCab2:12:17437674:17447703:-1 gene:ENSECAG00000006504 transcript:ENSECAT00000006618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPLLLALLFGAVSALPLRIETSNFESPLGDDTLPQDREMPERGAMEAPREGMMLPEGE
EEGGSGSEDDPEEEGLIKSVSALEEVDKDFQCPKEEDTIKLEGIPGCKTSRFIVVMTARM
FHQAQNVCRRCYRGNLVSIHSYHLNYRLQCSVRCINQGQVWIGGIRRGRRCRRRFRWTDG
SRWNFSYWASGQPRKGRGRCVALCTRGGHWRRVPCSRRLPFICSS
Download sequence
Identical sequences F7ADF3
9796.ENSECAP00000004714 ENSECAP00000004714 ENSECAP00000004714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]