SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004794 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004794
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000233
Family Ankyrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004794   Gene: ENSECAG00000006753   Transcript: ENSECAT00000006709
Sequence length 183
Comment pep:known_by_projection chromosome:EquCab2:15:347665:348216:-1 gene:ENSECAG00000006753 transcript:ENSECAT00000006709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGKKASQYLSPSIAEEIKNLVGALDEEDG
ESAAGSGGGRWRLSKVLPSHLITYKLSHVLEDGGDHHHHHHLAEGWAGGKAKEQGRKASG
SSTGRIKPRLNKIRFRTQIIHTTPCSFRDPEQPLEEGEEEEEDRSLKGHSSSFKLRPKSN
VFG
Download sequence
Identical sequences F7A325
ENSECAP00000004794 ENSECAP00000004794 9796.ENSECAP00000004794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]