SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004855 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004855
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-26
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 124-254
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004855
Domain Number - Region: 268-399
Classification Level Classification E-value
Superfamily PH domain-like 0.000152
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004855   Gene: ENSECAG00000006257   Transcript: ENSECAT00000006778
Sequence length 516
Comment pep:known_by_projection chromosome:EquCab2:15:90331330:90553877:-1 gene:ENSECAG00000006257 transcript:ENSECAT00000006778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTKTGIALLHDEGSGNAYDVRVKLTKEVLTIQKQDVICVSGSNPSANHRTVTLRRQPVGG
LGLSIKGGAEHRVPVVISKIFKDHAADQTGMLFIGDAVLQVNGINVENATHEEVVHLLRN
AGDEVTVTVEYLREAPSFLKLPLGSPGPSSDHGSGASSPLFDSGLHLNGTSGNTAPPSPS
SPIANEPKYEKRWLDTLSVPLSMARISRCKAGTEKLRSSAFEVLALDGVSTGVLQFYTAQ
ESADWLRAVSANISDLTLQNMKMANKCCSPCDQVVHMGWVNERLEGADSSQTFRPKFLAL
RGASFYIFSSPPVSTLDWVRAEKIYNLCEVLFKVHKFWLTDDCWLQANFYLGLHDFDLED
QRPYCFSVMVGHGKGHFFNVELGSELAVWEKSFQRATFMEVQRTGSKTYMCSWQGEVLCF
TVDFAVGFTCFDSKTKNVLWRFRFSQLKGSSDDGKTRVKLLFQNLDTKQIEMKELEFQDL
TAVLHCVHSFIAAKVASVDPAFVDSQSVARKYMCSN
Download sequence
Identical sequences F7BSF8
9796.ENSECAP00000004855 ENSECAP00000004855 ENSECAP00000004855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]