SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004886 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004886
Domain Number 1 Region: 261-536
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.52e-83
Family Leukotriene A4 hydrolase catalytic domain 0.00039
Further Details:      
 
Domain Number 2 Region: 46-254
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 5.75e-56
Family Leukotriene A4 hydrolase N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004886   Gene: ENSECAG00000003636   Transcript: ENSECAT00000006811
Sequence length 942
Comment pep:known_by_projection chromosome:EquCab2:14:72009784:72037550:1 gene:ENSECAG00000003636 transcript:ENSECAT00000006811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLSIKWPLASMSFLLSSLMILFTVSTPSWCQRSKTISPKASDGTPFPWDKMRLPERVI
PVHYNLMIHANLTTLTFEGTTEVEIRASQPTSAIILHSHHLQISRATLRKGAGERQSEKP
LRVLEYPSHEQIALLAPEPLVVGLPYTVVIDYAGNLSETFHGFYKSTYRTKEGEVRILAS
THFEPTAARMAFPCFDEPAFKASFSVKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSIYAVPDKINQADYALDTAVTLLEFYEDYFNI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESSLLFDAEKSSVSSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEYVSVSVTHPELKVEDYFLGKCFSAMEVDALNSSHPV
STPVENPAQIREMFDDVSYEKGACILNMLRDYLGADAFKSGVVQYLQKYSYKNTKNEDLW
NSMANICPTDGAQRMDGFCSRGQHSSSSSHWRQEGLDVKTMMNTWTLQKGFPLVTITVRG
RNVHMKQEHYMKGPEDAPDTGYLWHVPLTFITSKSDSVHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLIDLLKRTHTAISSNDRASLINNAFQLVSIGKVSIEKALD
LILYLKQETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKSFLIRLLRDLIDKQTWTDE
GSVSERMLRSQLLLLACVRKYQPCVQRAEGYFREWKEANGNLSLPSDVTMAVFAVGAQNP
EGWDFLFSKYQSSLSSTEKNRIEFALCMSQNKEKLQWLLDQSFKGDIIKTQEFPDILRSI
GRNPVGYPLAWKFLRENWNKLVQKFELGSPSISYMVMGTTNQFSTRARLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIKVWLQNEKLELL
Download sequence
Identical sequences F7BLK5
ENSECAP00000004886 ENSECAP00000004886 NP_001296210.1.31192 9796.ENSECAP00000004886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]