SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004898 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004898
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily SEA domain 0.0000000811
Family SEA domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004898
Domain Number - Region: 65-99
Classification Level Classification E-value
Superfamily Photosystem II 10 kDa phosphoprotein PsbH 0.0497
Family PsbH-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004898   Gene: ENSECAG00000006646   Transcript: ENSECAT00000006823
Sequence length 174
Comment pep:known_by_projection chromosome:EquCab2:5:42711713:42713612:1 gene:ENSECAG00000006646 transcript:ENSECAT00000006823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIYKQEDFLSLSAMKFSPGSVVVESTLAFQEGTIDAQEVKTLFDKGATEAARYNLDISRV
SVNDVPFPSSTQSGSGVPGWGIALLVLVCVLVALAIIYLVALAVCQCRRKNYGQLDIFPT
RDAYHPMSEYPTYHTHGRYVPPGSTRRSPYEEVSSGNGGSSLSYTNPAATSANL
Download sequence
Identical sequences F7BL38
9796.ENSECAP00000004898 ENSECAP00000004898 ENSECAP00000004898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]