SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004906 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004906
Domain Number 1 Region: 335-399
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.13e-21
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 2 Region: 276-331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 215-271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000183
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 148-222
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000607
Family Complement control module/SCR domain 0.00013
Further Details:      
 
Domain Number 5 Region: 91-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000223
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004906
Domain Number - Region: 20-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00192
Family Complement control module/SCR domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004906   Gene: ENSECAG00000006816   Transcript: ENSECAT00000006831
Sequence length 405
Comment pep:novel chromosome:EquCab2:30:24606824:24654014:-1 gene:ENSECAG00000006816 transcript:ENSECAT00000006831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLINVIVTFWVSGVHGQVKPCDFPEIKHGYLYDERYYKPYFPVPIGKYYYYYCNQNFL
TPSNYRGGYIYCRAEGWSPAVPCLRQCTSTHLENGKFPYWGRTYLQGESVKVECYSGYSL
PDQQSLMTCTENGWSPPPRCIRVEKTPCSQPPRIEHGTIESSKSTEERKERSEPKRYVHG
TRLSYICEDGFRLSEGDGITCHMGKWSSPPQCVDVSCKKPPEVKNAITSNHMSRYPSGER
VRYECIKPFYPFGEIYVTCLNGIWTDPPQCKDPRGKCGPPPPIDNGDITTFPSPAYPPGS
TVEYQCQSLHQLQGNRVITCRNGEWTKPPKCLDSCVISLEMMEKHNIELRWSGEKKLYSE
TGDVVEFACKPGYRAKRDSAEFRATCREGKLEYPTCERQRFNTRS
Download sequence
Identical sequences F6U1J0
ENSECAP00000004906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]