SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004959 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000004959
Domain Number - Region: 53-134
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00102
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004959   Gene: ENSECAG00000006924   Transcript: ENSECAT00000006889
Sequence length 182
Comment pep:novel chromosome:EquCab2:29:4944611:4945156:1 gene:ENSECAG00000006924 transcript:ENSECAT00000006889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNMFQAREQDKTPEKELNETEISNLPDKEFKQKLIRMFTDLERRMDEHSEYINKEL
ENIKKNQSEMKTTIPEMKNSLEGLNSRADDTEEWISEVDKRLEEITQAEEIQEKRIREND
NNLRELWDNIKHTNNHITGVPEGEERNKRVENLFQDIIAENFPNLRKEIDIQVQEARRAS
NK
Download sequence
Identical sequences F6V6I5
ENSECAP00000004959 ENSECAP00000004959 9796.ENSECAP00000004959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]