SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005000 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005000
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily PR-1-like 8.76e-57
Family PR-1-like 0.00000123
Further Details:      
 
Domain Number 2 Region: 189-245
Classification Level Classification E-value
Superfamily Crisp domain-like 3.03e-18
Family Crisp domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005000   Gene: ENSECAG00000006482   Transcript: ENSECAT00000006933
Sequence length 245
Comment pep:known chromosome:EquCab2:20:47721076:47745394:-1 gene:ENSECAG00000006482 transcript:ENSECAT00000006933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPVLLFLAAVLLPFFPASGQDPGFAALSITKSEVQKEIVNKHNDLRRTVSPLASNML
KMQWDSKTATNAQNWANKCLLQHSKAEDRAVGTMKCGENLFMSSIPNSWSDAIQNWHDEV
HDFKYGVGPKTPNAVVGHYTQVVWYSSYRVGCGIAYCPKQGTLKYYYVCQYCPAGNYVNK
INTPYEQGTPCARCPGNCDNGLCTNSCEYEDLVSNCDSLKKIAGCEHELLKENCKATCRC
ENKIY
Download sequence
Identical sequences F7BWJ9
ENSECAP00000005000 9796.ENSECAP00000005000 ENSECAP00000005000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]