SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005039 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005039
Domain Number 1 Region: 205-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 268-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000027
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 145-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000107
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 4 Region: 89-151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000406
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 5 Region: 22-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000157
Family Complement control module/SCR domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005039
Domain Number - Region: 330-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000944
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number - Region: 380-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00459
Family Complement control module/SCR domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005039   Gene: ENSECAG00000006816   Transcript: ENSECAT00000006979
Sequence length 421
Comment pep:novel chromosome:EquCab2:30:24614070:24677349:-1 gene:ENSECAG00000006816 transcript:ENSECAT00000006979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLINVILIFWVSCAHGQGKTCDFPEIKHGNIYDENRYKQSFPVAVGKYFYYSCHYSFV
SRSQSLWTAIMCTEEGWSPAPKCLRQCFFPWVENGHSASSGQTHWEGDTVQIVCDKGYSL
PNNQSNITCIESGWSIHPKCSPIRKECKIPQIERYLNVDPKNDIYKVGSVLKFSCRQRHI
IVGADSVQCYHFGWSPGFPTCKAEVRSCGPPPQLPNGEVKEAQKQEYGHSEVVECVCHPG
FLLKGSNKIQCVDGEWTTLPTCIEEDSTCGDVPGLDHGYVEPSDPPYRHGDSVAFTCREA
FTMIGHKSIMCIRGTWTQLPQCIATDELAKCKLSKLITREESYSHKIEFNHNANISYKCR
GKYKHSTCVNGRWEPEATCPEVQMQLCPPPPQIPNAQDMTTTVNYQDGEKISILCKEEYL
I
Download sequence
Identical sequences F7E3H8
ENSECAP00000005039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]